Iterative masking DMS

Orchestrating molecular design workflows.

Iterative masking deep mutational scanning (DMS) turns a masked language model into a proposer of substitutions. Instead of enumerating every point mutation and scoring it externally, you mask a position, ask the model which residue it would most like to see there, and take that argmax as the preferred variant. The SDK packages this as IterativeMaskingDMSConfig, a source config you drop into a GenerativePipeline. The pipeline runs the masking rounds, decodes the logits, deduplicates the variants, and hands you a tidy DataFrame — with DuckDB caching and resume for free.

What it does

Given a parent_sequence and a list of positions, the config walks up to two greedy rounds:

  1. Round 1 (single-point). Each target position is masked in the parent and sent to model_name. The model returns per-token logits; the SDK takes the argmax over the amino-acid alphabet and records that residue as the position’s preferred substitution. With exclude_synonymous=True (the default), any argmax that equals the wild-type residue is dropped.

  2. Round 2 (two-point). Each round-1 variant becomes the new starting sequence. The SDK masks every other target position, queries the model again, and combines the round-1 and round-2 argmax residues into a two-point mutant. Duplicate sequences are collapsed.

Only rounds=1 and rounds=2 are implemented; rounds > 2 raises a ValueError at construction, as does rounds < 1. Because the procedure needs per-token logit arrays, action must be 'predict' — the sole allowlisted value.

How it differs from saturation mutagenesis

Both configs produce mutant libraries, but the search strategy is opposite. In Saturation mutagenesis, you exhaustively enumerate every substitution and lean on an external scorer (ThermoMPNN-D, ESM2StabP) to rank them. Here, the model itself picks the substitution at each position via a logits argmax, so there is no separate scoring model and no ranking step — the candidate set is whatever the language model prefers. That makes iterative masking far cheaper (one masked query per position, not 19) and biased toward residues the model considers natural, rather than an unbiased sweep. Reach for it when you want the model’s opinion on plausible substitutions; reach for saturation mutagenesis when you want a complete, scorer-ranked map of a fitness landscape.

A worked example

The example below runs a two-round greedy DMS at three positions of a parent sequence using ESM2-650M, then reads the results.

python
from biolm.pipeline import GenerativePipeline, IterativeMaskingDMSConfig

config = IterativeMaskingDMSConfig(
    parent_sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ",
    model_name="esm2-650m",
    positions=[2, 5, 8],       # 0-indexed; None -> probe every position
    rounds=2,                  # round 1: single-point, round 2: two-point
    exclude_synonymous=True,   # skip argmax residues equal to wild type
    batch_size=32,
)

pipeline = GenerativePipeline(configs=[config])
pipeline.run()

df = pipeline.results()
print(df[["sequence", "dms_round", "dms_pos1", "dms_aa1", "dms_pos2", "dms_aa2"]])

Key configuration fields

Field

Default

Meaning

parent_sequence

Wild-type sequence to mutate (required; cannot be empty).

model_name

MLM model slug returning logits, e.g. 'esm2-650m' (required).

positions

None

0-indexed positions to probe. None probes every position. Out-of-range indices raise a ValueError.

rounds

2

Number of masking rounds. Only 1 (single-point) and 2 (two-point) are supported.

mask_token

''

Token inserted at masked positions before each query.

alphabet

'ACDEFGHIKLMNPQRSTVWY'

Amino-acid vocabulary used to identify valid residues in the logits.

exclude_synonymous

True

Skip round-1 variants whose argmax equals the wild-type residue.

batch_size

32

Sequences per API request.

label

None

Optional label stored as source_label in the results.

action

'predict'

API action. Only 'predict' is allowed; the argmax procedure requires per-token logit arrays.

Reading the results

Call pipeline.run() first — it returns per-stage summaries, not rows — then pipeline.results() (an alias for get_final_data()) to get the pandas DataFrame. Alongside sequence, each row carries provenance columns describing how the variant was built:

  • dms_round1 for single-point variants, 2 for two-point variants.

  • dms_pos1 / dms_aa1 — the first mutated position and its argmax residue.

  • dms_pos2 / dms_aa2 — the second position and residue (populated only for round-2 rows).

  • source_label — the config’s label (None if unset); always present.

Interpretation

The variant counts are worth anticipating. Round 1 yields at most one row per position — fewer when exclude_synonymous drops synonymous argmax calls or a model returns no usable logits. Round 2 expands each round-1 variant against the other positions, then deduplicates, so the count is bounded by the number of distinct two-point combinations rather than a fixed top_n. If a batch errors or the model omits vocab_tokens for a logits response, the affected rows are skipped, so a low survivor count usually points to failed batches or a model that does not expose a decodable vocabulary.

Because a GenerativePipeline is a full pipeline, you can chain downstream prediction stages onto the generated variants — for example, folding the survivors or scoring them with a stability model — exactly as in the saturation-mutagenesis workflow.

Where to go next

We speak the language of bio-AI

© 2022 - 2026 BioLM. All Rights Reserved.

Iterative masking DMS | BioLM Docs