Saturation mutagenesis

Orchestrating molecular design workflows.

Saturation mutagenesis is the workhorse of protein engineering: take a parent sequence, enumerate every single amino-acid substitution at the positions you care about, score each variant with a model, then keep the best ones. The SDK packages this as a single declarative config, SaturationMutagenesisConfig, that you drop into a GenerativePipeline. The pipeline builds the single-mutant library internally, scores it in batches, sorts by your chosen field, and returns the top top_n variants — with DuckDB caching and resume for free.

What it does

Given a parent_sequence of length L, the config generates up to 19 × L variants (every non-wild-type residue at every position), or just the positions you list. Each variant is sent to scoring_model, the numeric value at score_field is extracted, and the library is ranked. Only the top top_n rows survive into the results. No separate generation step is needed — the candidate library is the enumeration.

When to use it

Reach for saturation mutagenesis whenever you want an exhaustive, unbiased sweep of point mutations rather than sampled novelty. The canonical case is stability engineering: find substitutions that lower the folding free energy (ΔΔG).

  • ThermoMPNN-D (thermompnn-d) — a structure-aware ΔΔG predictor. It needs a PDB structure and reports a ddg field per mutation. This is the primary example below and matches the class defaults (score_field="ddg", ascending=True).

  • ESM2StabP (esm2stabp) — a sequence-only stability predictor. Use it as a drop-in alternative when you have no structure: leave pdb_str=None and set score_field to whatever key that model returns.

The same pattern extends to any per-variant scalar — activity proxies, solubility, expression — as long as the model exposes it in its response.

A worked example

The example below scans three positions of a parent sequence with ThermoMPNN-D, keeps the 25 most stabilizing variants, and (optionally) folds each survivor with ESMFold to attach a confidence score.

python
from biolm.pipeline import GenerativePipeline, SaturationMutagenesisConfig

config = SaturationMutagenesisConfig(
    parent_sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ",
    scoring_model="thermompnn-d",
    positions=[3, 7, 10],          # 0-indexed; None -> scan all positions
    score_field="ddg",            # key in the API response holding ΔΔG
    top_n=25,                      # keep the 25 best variants
    ascending=True,                # lower ΔΔG = more stabilizing
    pdb_str=open("protein.pdb").read(),  # structure-aware models require this
    batch_size=8,
)

pipeline = GenerativePipeline(configs=[config])
pipeline.run()

df = pipeline.results()
print(df[["sequence", "sat_position", "sat_wt_aa", "sat_mut_aa", "ddg"]])

Key configuration fields

Field

Default

Meaning

parent_sequence

Wild-type sequence to mutate (required).

scoring_model

BioLM model slug used to score variants, e.g. 'thermompnn-d'.

positions

None

0-indexed positions to enumerate. None scans every position.

score_field

'ddg'

Key inside each model response holding the numeric score. Dotted paths ('a.b') are supported for nested responses.

top_n

50

Number of top-ranked variants to keep. None keeps all.

ascending

True

If True, lower scores rank higher (correct for ΔΔG).

exclude_synonymous

True

Skip substitutions equal to the wild-type residue.

pdb_str

None

Raw PDB file contents (a string, not a path). Required by structure-aware models like ThermoMPNN-D; leave None for ESM2StabP.

scoring_action: predict vs. score

scoring_action selects which client method runs the variants. The default, 'predict', calls the model’s predict endpoint — correct for ThermoMPNN-D and ESM2StabP. Set scoring_action="score" only when your model exposes a dedicated score action. Both values are allowlisted; anything else raises a ValueError at construction.

Optional downstream prediction

Because a GenerativePipeline is a full pipeline, you can chain more stages onto the ranked survivors. A common follow-up is folding the top variants to gauge structural confidence:

python
pipeline = GenerativePipeline(configs=[config])
pipeline.add_prediction("esmfold", extractions="mean_plddt", columns="plddt")
pipeline.run()
df = pipeline.results()

This adds a plddt column to the results, computed only for the variants that passed ranking — so you fold 25 sequences, not the whole library.

Reading the results

pipeline.results() (an alias for get_final_data()) returns a pandas DataFrame — call it after pipeline.run(), which returns per-stage summaries, not rows. Alongside sequence and the score column (named after score_field, e.g. ddg), the frame carries provenance columns:

  • sat_position — the 0-indexed position that was mutated.

  • sat_wt_aa — the wild-type residue at that position.

  • sat_mut_aa — the substituted residue.

  • source_label — the config’s label (None if unset); always present.

Interpretation

For stability work with ThermoMPNN-D, the defaults already point you the right way: ascending=True with score_field="ddg" surfaces the most stabilizing mutants first, because a more negative ΔΔG means a more stable fold. Flip ascending=False when a higher score is better (e.g. an activity proxy).

One caveat: top_n is a ceiling, not a guarantee. If the model fails to return a value for some variants — a missing score_field, an errored batch — those rows are dropped before ranking, so you may see fewer than top_n results. Widen positions or inspect the per-item errors if the survivor count looks low.

Where to go next

We speak the language of bio-AI

© 2022 - 2026 BioLM. All Rights Reserved.

Saturation mutagenesis | BioLM Docs