Cover More Sequence Space, Screen Less: Diversity Selection with Embeddings¶

Cluster your library in sequence space with ESM2 embeddings and select diverse representatives before you screen.

Postman API Docs

Python SDK Docs

What you'll learn:

Generating ESM2-8m embeddings via the pipeline SDK
K-means clustering with silhouette score selection
PCA visualization of sequence space
Diversity sampling across clusters

export BIOLMAI_TOKEN=your-token-here

Setup¶

import os
from biolmai.pipeline import (
    DataPipeline, DuckDBDataStore,
    ThresholdFilter, RankingFilter,
    ValidAminoAcidFilter, EmbeddingSpec,
    DiversitySamplingFilter,
)

TOKEN = os.environ.get("BIOLMAI_TOKEN", "")
if not TOKEN:
    raise EnvironmentError(
        "Set BIOLMAI_TOKEN before running.\n"
        "Get one at https://biolm.ai/ui/accounts/user-api-tokens/"
    )
import numpy as np
import matplotlib.pyplot as plt
from sklearn.decomposition import PCA
from sklearn.metrics import silhouette_score
from sklearn.cluster import KMeans

Peptide library¶

50 antimicrobial peptides from three families: magainins, defensins, and designed sequences.

MY_50_PEPTIDES = [
    "GIGKFLHSAKKFGKAFVGEIMNS", "GIGKFLHSAGKFGKAFVGEIMKS", "GLFDIIKKIAESF",
    "GLFDIVKKVVGALGSL", "FLPLILRKIVTAL", "GIKKFLGSIWKFIKAFVKEIMN",
    "GLFDIIKKIAESFLPKV", "GIGKFLHSAKKFGKAFV", "GIGKFLHSAK", "GIGKFLHSAKKFGK",
    "[LL-37, 37 aa]", "RLFDKIRQVIRKF",
    "KWKLFKKIPKFLHLAKKF", "KWKLFKKIPKFLHLAK", "FKRIVQRIKDFL",
    "RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQATQIAK",
    "KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK",
    "GIGAVLKVLTTGLPALISWIKRKRQQ", "VDKGSYLPRPTPPRPIYNRN", "GKPRPYSPRPTSHPRPIRV",
    "KLAKLAKKLAKLAK", "LKLLKKLLKLLKKL", "RRWWRRWWRR", "KWKWKWKWKW",
    "RRLCRIVVIRVCR", "RRWQWR", "RWRWRW", "KFLKKAKKFGK",
    "KWKLFKKI", "RLFDKIRQ",
    "ACYCRIPACIAGERRYGTCIYQGRLWAFCC", "GCSKNKGCSVDKECAAFGSR",
    "DCSCFGGKGETACNKCKTPEGKPCTEGKPCK", "GFCKLCCNPACGPNYKGICIDM",
    "AFGKQLAKLAKSKLAKLAKLAK", "KLALKLALKALKAALKLA",
    "WKWLKKWLKKLK", "RWKKWWRRKK", "KFKKLFKKLKK",
    "FLGALFKALSKLL", "ALLKFLLKFLLK", "GLLDFLK",
    "KKLFKKILKYL", "FFKDEL", "ILKKWPWWPWRR",
    "GLWSKIKEVGKEAAKAAAKAAGKAALNAVTGGGKPG",
    "KLKLLLLLKLK", "WKLFKKIKVWK", "KWKWFKKIKVWK", "KLFKKIKVWKK",
]
print(f"{len(MY_50_PEPTIDES)} peptides")

50 peptides

Embed with ESM2-8m¶

ds = DuckDBDataStore("cluster_demo.duckdb")

cp = DataPipeline(sequences=MY_50_PEPTIDES, datastore=ds, verbose=True)
cp.add_filter(ValidAminoAcidFilter(), stage_name="validate")
cp.add_prediction(
    "esm2-8m", action="encode",
    embedding_extractor=EmbeddingSpec(key="embeddings", layer=6),
    stage_name="embed", depends_on=["validate"],
)
cp.add_clustering(
    method="kmeans", n_clusters=3,
    similarity_metric="embedding", embedding_model="esm2-8m",
    stage_name="cluster_k3", depends_on=["embed"],
)
cp.run()

Added stage: FilterStage('validate')
Added stage: PredictionStage('embed', depends_on=['validate'])
Added stage: ClusteringStage('cluster_k3', depends_on=['embed'])

############################################################
# Pipeline: DataPipeline
# Run ID: 20260617_141553_ba38f1d1
# Initial sequences: 50
# Streaming: ENABLED
############################################################

Execution plan: 3 level(s)
  Level 1: validate
  Level 2: embed
  Level 3: cluster_k3

============================================================
Stage: validate
Input: 50 sequences
  Applying filter: ValidAminoAcidFilter(alphabet='ACDEFGHIKLMNPQRSTVWY')
  Filtered out: 0/50
  Remaining: 50

StageResult(validate: in=50, out=50, cached=0, computed=0, filtered=0, time=0.0s)
============================================================

============================================================
Stage: embed
Input: 50 sequences
Depends on: validate
  Cached: 0/50
  To compute: 50
  Calling esm2-8m.encode...

Completed: 50 sequences in 2 batches (max 5 concurrent)

StageResult(embed: in=50, out=50, cached=0, computed=50, filtered=0, time=2.2s)
============================================================

============================================================
Stage: cluster_k3
Input: 50 sequences
Depends on: embed
  Clustering 50 sequences using kmeans...
  Loading embeddings from esm2-8m...
  Found 3 clusters
  Silhouette score: 0.151

StageResult(cluster_k3: in=50, out=50, cached=0, computed=50, filtered=0, time=0.2s)
============================================================

############################################################
# Pipeline completed in 2.5s
# Final sequences: 50
############################################################

{'validate': StageResult(validate: in=50, out=50, cached=0, computed=0, filtered=0, time=0.0s),
 'embed': StageResult(embed: in=50, out=50, cached=0, computed=50, filtered=0, time=2.2s),
 'cluster_k3': StageResult(cluster_k3: in=50, out=50, cached=0, computed=50, filtered=0, time=0.2s)}

Choose k with silhouette scores¶

Because embeddings are cached, re-clustering at different k values costs nothing.

sequence_ids = [r[0] for r in ds.conn.execute("SELECT sequence_id FROM sequences").fetchall()]
emb_map = ds.get_embeddings_bulk(sequence_ids, model_name="esm2-8m")
mat = np.stack([emb_map[sid] for sid in sequence_ids])

scores = {}
for k in range(2, 9):
    labels = KMeans(n_clusters=k, random_state=42, n_init=10).fit_predict(mat)
    scores[k] = silhouette_score(mat, labels)
    print(f"k={k}: silhouette={scores[k]:.3f}")

best_k = max(scores, key=scores.get)
print(f"\nBest k: {best_k}")

k=2: silhouette=0.354
k=3: silhouette=0.210
k=4: silhouette=0.223
k=5: silhouette=0.257
k=6: silhouette=0.246
k=7: silhouette=0.269
k=8: silhouette=0.257

Best k: 2

PCA visualization¶

cluster_labels = [
    int(r[0]) for r in ds.conn.execute(
        "SELECT CAST(value AS INTEGER) FROM predictions WHERE prediction_type='cluster_k3' ORDER BY sequence_id"
    ).fetchall()
]

pca = PCA(n_components=2)
coords = pca.fit_transform(mat)

fig, ax = plt.subplots(figsize=(8, 6))
scatter = ax.scatter(coords[:, 0], coords[:, 1], c=cluster_labels,
                     cmap="Set1", edgecolors="black", linewidth=0.5, alpha=0.8, s=60)
plt.colorbar(scatter, ax=ax, label="Cluster")
ax.set_xlabel(f"PC1 ({pca.explained_variance_ratio_[0]:.1%} variance)")
ax.set_ylabel(f"PC2 ({pca.explained_variance_ratio_[1]:.1%} variance)")
ax.set_title("ESM2-8m embedding space — K-means clusters (k=3)")
plt.tight_layout()
plt.show()

Diversity sampling¶

Select 20 maximally diverse representatives spanning all clusters.

diverse_ds = DuckDBDataStore("diverse_demo.duckdb")

dp = DataPipeline(sequences=MY_50_PEPTIDES, datastore=diverse_ds, verbose=True)
dp.add_filter(ValidAminoAcidFilter(), stage_name="validate")
dp.add_prediction(
    "esm2-8m", action="encode",
    embedding_extractor=EmbeddingSpec(key="embeddings", layer=6),
    stage_name="embed", depends_on=["validate"],
)
dp.add_clustering(
    method="kmeans", n_clusters=3,
    similarity_metric="embedding", embedding_model="esm2-8m",
    stage_name="cluster", depends_on=["embed"],
)
dp.add_filter(DiversitySamplingFilter(n_samples=20, method="random"), stage_name="diverse_20")
dp.run()
dp.summary()

Added stage: FilterStage('validate')
Added stage: PredictionStage('embed', depends_on=['validate'])
Added stage: ClusteringStage('cluster', depends_on=['embed'])
Added stage: FilterStage('diverse_20', depends_on=['cluster'])

############################################################
# Pipeline: DataPipeline
# Run ID: 20260617_141556_d43fb8a4
# Initial sequences: 50
# Streaming: ENABLED
############################################################

Execution plan: 4 level(s)
  Level 1: validate
  Level 2: embed
  Level 3: cluster
  Level 4: diverse_20

============================================================
Stage: validate
Input: 50 sequences
  Applying filter: ValidAminoAcidFilter(alphabet='ACDEFGHIKLMNPQRSTVWY')
  Filtered out: 0/50
  Remaining: 50

StageResult(validate: in=50, out=50, cached=0, computed=0, filtered=0, time=0.0s)
============================================================

============================================================
Stage: embed
Input: 50 sequences
Depends on: validate
  Cached: 0/50
  To compute: 50
  Calling esm2-8m.encode...

Completed: 50 sequences in 2 batches (max 5 concurrent)

StageResult(embed: in=50, out=50, cached=0, computed=50, filtered=0, time=0.6s)
============================================================

============================================================
Stage: cluster
Input: 50 sequences
Depends on: embed
  Clustering 50 sequences using kmeans...
  Loading embeddings from esm2-8m...
  Found 3 clusters
  Silhouette score: 0.151

StageResult(cluster: in=50, out=50, cached=0, computed=50, filtered=0, time=0.1s)
============================================================

============================================================
Stage: diverse_20
Input: 50 sequences
Depends on: cluster
  Applying filter: DiversitySamplingFilter(n=20, method='random')
  Filtered out: 30/50
  Remaining: 20

StageResult(diverse_20: in=50, out=20, cached=0, computed=0, filtered=30, time=0.0s)
============================================================

############################################################
# Pipeline completed in 0.8s
# Final sequences: 20
############################################################

Cleanup¶

ds.close(); diverse_ds.close()
import os
for f in ["cluster_demo.duckdb", "diverse_demo.duckdb"]:
    if os.path.exists(f): os.remove(f)

Next Steps¶

Check out additional tutorials at jupyter.biolm.ai, or head over to our BioLM Documentation to explore additional models and functionality.

All Examples

Cover More Sequence Space, Screen Less: Diversity Selection with Embeddings¶

Setup¶

Peptide library¶

Embed with ESM2-8m¶

Choose k with silhouette scores¶

PCA visualization¶

Diversity sampling¶

Cleanup¶

Next Steps¶

See more use-cases and APIs on your BioLM Console Catalog.¶

BioLM hosts deep learning models and runs inference at scale. You do the science.¶

Contact us to learn more.¶

Accelerate yourLead generation

	Stage	Input	Output	Filtered	Computed	Time (s)
0	validate	50	50	0	0	0.0
1	embed	50	50	0	50	0.6
2	cluster	50	50	0	50	0.1
3	diverse_20	50	20	30	0	0.0