Embedding Tools for Navigating a Peptide Library¶
Represent sequences as vectors: find analogs by cosine similarity, detect outliers, and visualise property landscapes with PCA.
What you'll learn:
- Tool 1: "Find me more like this one" — cosine similarity search
- Tool 2: "Is this sequence weird?" — outlier detection
- Tool 3: "Show me the landscape" — PCA colored by predicted property
export BIOLMAI_TOKEN=your-token-here
Setup¶
import os
from biolmai.pipeline import (
DataPipeline, DuckDBDataStore,
ThresholdFilter, RankingFilter,
ValidAminoAcidFilter, EmbeddingSpec,
DiversitySamplingFilter,
)
TOKEN = os.environ.get("BIOLMAI_TOKEN", "")
if not TOKEN:
raise EnvironmentError(
"Set BIOLMAI_TOKEN before running.\n"
"Get one at https://biolm.ai/ui/accounts/user-api-tokens/"
)
import numpy as np
import matplotlib.pyplot as plt
from sklearn.decomposition import PCAGet embeddings for a peptide library¶
LIBRARY = [
"GIGKFLHSAKKFGKAFVGEIMNS", "GLFDIIKKIAESF", "KLAKLAKKLAKLAK",
"RRWWRRWWRR", "KWKLFKKI", "GIGKFLHSAK", "RLFDKIRQ",
"GLFDIVKKVVGALGSL", "FLPLILRKIVTAL", "KWKWKWKWKW",
"GIKKFLGSIWKFIKAFVKEIMN", "RRLCRIVVIRVCR", "RRWQWR",
"RWRWRW", "FKRIVQRIKDFL", "KWKLFKKIPKFLHLAK",
"GLFDIIKKIAESFLPKV", "GIGKFLHSAKKFGKAFV", "KWKLFKKIPKFLHLAKKF",
"[LL-37, 37 aa]",
]
HIT_SEQUENCE = LIBRARY[0] # our "hit" from a previous screen
ds = DuckDBDataStore("embedding_demo.duckdb")
pipeline = DataPipeline(sequences=LIBRARY, datastore=ds, verbose=True)
pipeline.add_prediction(
"esm2-8m", action="encode",
embedding_extractor=EmbeddingSpec(key="embeddings", layer=6),
stage_name="embed",
)
pipeline.run()
sequence_ids = [r[0] for r in ds.conn.execute("SELECT sequence_id FROM sequences ORDER BY sequence_id").fetchall()]
sequences = [r[0] for r in ds.conn.execute("SELECT sequence FROM sequences ORDER BY sequence_id").fetchall()]
emb_map = ds.get_embeddings_bulk(sequence_ids, model_name="esm2-8m")
mat = np.stack([emb_map[sid] for sid in sequence_ids])
print(f"Embedding matrix: {mat.shape}")Tool 1: Find me more like this one¶
Cosine similarity on embeddings gives a ranked list of nearest neighbors.
hit_idx = sequences.index(HIT_SEQUENCE)
hit_vec = mat[hit_idx]
hit_norm = hit_vec / np.linalg.norm(hit_vec)
sims = []
for i, sid in enumerate(sequence_ids):
if i == hit_idx:
continue
v = mat[i]
sim = np.dot(hit_norm, v / np.linalg.norm(v))
sims.append((sim, sequences[i]))
sims.sort(reverse=True)
print(f"Query: {HIT_SEQUENCE}\n")
print("Top 5 most similar sequences:")
for sim, seq in sims[:5]:
print(f" {sim:.3f} {seq}")Tool 2: Is this sequence weird?¶
Distance from the centroid flags outliers — contamination, misannotations, or genuinely novel variants.
centroid = mat.mean(axis=0)
distances = np.linalg.norm(mat - centroid, axis=1)
threshold = distances.mean() + 2 * distances.std()
print(f"Mean distance: {distances.mean():.3f}")
print(f"Outlier threshold (mean + 2σ): {threshold:.3f}\n")
outliers = [(dist, seq) for dist, seq in zip(distances, sequences) if dist > threshold]
if outliers:
print("Outlier sequences:")
for dist, seq in sorted(outliers, reverse=True):
print(f" distance={dist:.3f} {seq}")
else:
print("No outliers detected")Tool 3: Show me the landscape¶
PCA gives a 2D map of the library. Color by any property to see functional structure.
# First get Tm predictions for coloring
pipeline2 = DataPipeline(sequences=LIBRARY, datastore=ds, verbose=True)
pipeline2.add_prediction("temberture-regression", extractions="prediction", columns="melting_temperature")
pipeline2.run()
tm_rows = ds.conn.execute("""
SELECT s.sequence_id, p.value AS tm
FROM sequences s JOIN predictions p ON s.sequence_id = p.sequence_id
WHERE p.prediction_type = 'melting_temperature'
ORDER BY s.sequence_id
""").df()
tm_values = tm_rows["tm"].values
pca = PCA(n_components=2)
coords = pca.fit_transform(mat)
fig, axes = plt.subplots(1, 2, figsize=(13, 5))
# Left: colored by Tm
sc = axes[0].scatter(coords[:, 0], coords[:, 1], c=tm_values,
cmap="coolwarm", edgecolors="black", linewidth=0.3, alpha=0.85, s=60)
plt.colorbar(sc, ax=axes[0], label="Predicted Tm (°C)")
axes[0].set_xlabel(f"PC1 ({pca.explained_variance_ratio_[0]:.1%})")
axes[0].set_ylabel(f"PC2 ({pca.explained_variance_ratio_[1]:.1%})")
axes[0].set_title("Library landscape — colored by predicted Tm")
# Right: highlight outliers
is_outlier = distances > threshold
axes[1].scatter(coords[~is_outlier, 0], coords[~is_outlier, 1],
c="steelblue", edgecolors="black", linewidth=0.3, alpha=0.7, s=60, label="Normal")
axes[1].scatter(coords[is_outlier, 0], coords[is_outlier, 1],
c="crimson", edgecolors="black", linewidth=0.5, s=90, zorder=5, label="Outlier")
axes[1].set_title("Outlier detection (>2σ from centroid)")
axes[1].legend()
plt.tight_layout()
plt.show()
Cleanup¶
ds.close()
import os; os.remove("embedding_demo.duckdb")