Predict Stabilizing Variants via Deep Mutational Scan

While ESM2 has similar performance to ESM-1v, the latter is still a great option for performing an in silico deep mutational scan. ESM-1v is a collection of five models, trained on sequences from UniRef, each with different seeds. Ensembling these five models' scores can produce better results than a single ESM-1v model, for such broad topics like identifying stabilizing mutations.

Since these models were only trained on functional molecules, they are capable of assessing whether a new molecule might also be functional, or whether it has a disastrous mutation.

Imagine only learning and speaking English your whole life - could you identify whether a new English word is English? Probably. What about whether a Korean word is Korean? Or whether a French word is French? You might not be able to identify a Korean word as specifically Korean since you were only exposed to English; but you can tell that some foreign words are at least not-English. The idea is similar with this zero-shot model, ESM-1v: how likely is a sequence functional, since the model was only exposed to functional sequences.

We do this by masking each position and requesting the scores for each residue at that position. For a sequence of even a couple hundred residues, this is thousands of predictions from each of the 5 GPU-based models. BioLM has APIs to get these results at scale much faster than it would take to spin up these models on multiple GPUs alone.

import time
from biolmai import BioLM
from IPython.display import JSON  # Helpful UI for JSON display
import pandas as pd
from matplotlib import pyplot as plt
import seaborn as sns
# Let's use the sequence from the paper
# https://www.biorxiv.org/content/10.1101/2021.07.09.450648v2.full.pdf
WILDTYPE = "ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"

print("Sequence length: {}".format(len(WILDTYPE)))
Sequence length: 238

We can copy working Python code for making a request to BioLM.ai's ESM-1v API:

def esm1v_pred(seq):
    """Get un-masking predictions from any of the 5 ESM-1v models via REST API.
    
    From API docs: https://api.biolm.ai/#54d3367a-b5d1-4f18-aa44-23ae3914a446
    """
    assert '<mask>' in seq

    response = BioLM(entity=f"esm1v-all", action="predict", type="sequence", items=[seq])


    return response

Now test our function on the first residue and first model.

result = esm1v_pred('<mask>' + WILDTYPE[1:])  # First ESM-1v model
JSON(result)
<IPython.core.display.JSON object>

We can see that "M", or Methionine is the most likely starting AA. Methionine is a common starting AA amongst many organisms.

Next, We can examine predictions from the other ESM-1v models, then ensemble the likelihood scores for best results.

JSON(result["esm1v-n2"])
<IPython.core.display.JSON object>

You can observe the probabilities for each token (amino acid residue) differing between the two models.

Loading the data into a DF is simple.

pd.DataFrame.from_dict(result["esm1v-n2"], orient='columns')
token token_str score sequence
0 20 M 0.945713 M S K G E E L F T G V V P I L V E L D G D V N ...
1 4 L 0.004731 L S K G E E L F T G V V P I L V E L D G D V N ...
2 6 G 0.004624 G S K G E E L F T G V V P I L V E L D G D V N ...
3 8 S 0.004320 S S K G E E L F T G V V P I L V E L D G D V N ...
4 15 K 0.003869 K S K G E E L F T G V V P I L V E L D G D V N ...
5 7 V 0.003802 V S K G E E L F T G V V P I L V E L D G D V N ...
6 12 I 0.003527 I S K G E E L F T G V V P I L V E L D G D V N ...
7 5 A 0.003489 A S K G E E L F T G V V P I L V E L D G D V N ...
8 9 E 0.003188 E S K G E E L F T G V V P I L V E L D G D V N ...
9 11 T 0.003166 T S K G E E L F T G V V P I L V E L D G D V N ...
10 13 D 0.002908 D S K G E E L F T G V V P I L V E L D G D V N ...
11 18 F 0.002779 F S K G E E L F T G V V P I L V E L D G D V N ...
12 14 P 0.002708 P S K G E E L F T G V V P I L V E L D G D V N ...
13 17 N 0.002593 N S K G E E L F T G V V P I L V E L D G D V N ...
14 10 R 0.002212 R S K G E E L F T G V V P I L V E L D G D V N ...
15 19 Y 0.002082 Y S K G E E L F T G V V P I L V E L D G D V N ...
16 16 Q 0.001598 Q S K G E E L F T G V V P I L V E L D G D V N ...
17 21 H 0.001131 H S K G E E L F T G V V P I L V E L D G D V N ...
18 22 W 0.000831 W S K G E E L F T G V V P I L V E L D G D V N ...
19 23 C 0.000615 C S K G E E L F T G V V P I L V E L D G D V N ...

Let's scan the whole sequence now, using several of the five ESM-1v models. This should be fairly fast sequentially. Let's simply loop through each model and position. To ensemble and average predictions from all five models, we use the ESM-1v all endpoint which does this directly.

import copy

results = []

def f(idx, seq):
    if idx % 20 == 0:
        print("Submitting twenty positions from {}/{} with ESM-1v Model".format(idx, len(seq)))
    # Mask that position
    seq_masked = list(copy.copy(seq))
    seq_masked[idx] = '<mask>'
    seq_masked = ''.join(seq_masked)
    r = esm1v_pred(seq_masked)
    # Request the probabilities of each AA at that mask

    for mdl in range(1, 6):
        r_df = pd.DataFrame.from_dict(r[f"esm1v-n{mdl}"], orient='columns')
        r_df['model_num'] = mdl
        r_df['mask_pos'] = idx
        results.append(r_df)


ops = [f(i, WILDTYPE) for i in range(len(WILDTYPE))]
Submitting twenty positions from 0/238 with ESM-1v Model
Submitting twenty positions from 20/238 with ESM-1v Model
Submitting twenty positions from 40/238 with ESM-1v Model
Submitting twenty positions from 60/238 with ESM-1v Model
Submitting twenty positions from 80/238 with ESM-1v Model
Submitting twenty positions from 100/238 with ESM-1v Model
Submitting twenty positions from 120/238 with ESM-1v Model
Submitting twenty positions from 140/238 with ESM-1v Model
Submitting twenty positions from 160/238 with ESM-1v Model
Submitting twenty positions from 180/238 with ESM-1v Model
Submitting twenty positions from 200/238 with ESM-1v Model
Submitting twenty positions from 220/238 with ESM-1v Model
results[0]  # Look at the first result DF we made
token token_str score sequence model_num mask_pos
0 20 M 0.909230 M S K G E E L F T G V V P I L V E L D G D V N ... 1 0
1 4 L 0.008935 L S K G E E L F T G V V P I L V E L D G D V N ... 1 0
2 7 V 0.007254 V S K G E E L F T G V V P I L V E L D G D V N ... 1 0
3 6 G 0.007158 G S K G E E L F T G V V P I L V E L D G D V N ... 1 0
4 12 I 0.006674 I S K G E E L F T G V V P I L V E L D G D V N ... 1 0
5 8 S 0.006055 S S K G E E L F T G V V P I L V E L D G D V N ... 1 0
6 15 K 0.005998 K S K G E E L F T G V V P I L V E L D G D V N ... 1 0
7 11 T 0.005336 T S K G E E L F T G V V P I L V E L D G D V N ... 1 0
8 5 A 0.005292 A S K G E E L F T G V V P I L V E L D G D V N ... 1 0
9 18 F 0.005089 F S K G E E L F T G V V P I L V E L D G D V N ... 1 0
10 13 D 0.005014 D S K G E E L F T G V V P I L V E L D G D V N ... 1 0
11 9 E 0.004765 E S K G E E L F T G V V P I L V E L D G D V N ... 1 0
12 17 N 0.004459 N S K G E E L F T G V V P I L V E L D G D V N ... 1 0
13 19 Y 0.004456 Y S K G E E L F T G V V P I L V E L D G D V N ... 1 0
14 14 P 0.003537 P S K G E E L F T G V V P I L V E L D G D V N ... 1 0
15 10 R 0.003235 R S K G E E L F T G V V P I L V E L D G D V N ... 1 0
16 16 Q 0.002700 Q S K G E E L F T G V V P I L V E L D G D V N ... 1 0
17 21 H 0.001710 H S K G E E L F T G V V P I L V E L D G D V N ... 1 0
18 22 W 0.001501 W S K G E E L F T G V V P I L V E L D G D V N ... 1 0
19 23 C 0.001435 C S K G E E L F T G V V P I L V E L D G D V N ... 1 0

Concatenate the resulting DFs together.

results_df = pd.concat(results, axis=0)

results_df.shape
(23800, 6)
results_df.sample(5)  # Sample some of the results to get a preview
token token_str score sequence model_num mask_pos
10 11 T 0.046366 A S K G E E L F T G V V P I L V E L D G D V N ... 5 170
4 18 F 0.058498 A S K G E E L F T G V V P I L V E L D G D V N ... 1 118
17 21 H 0.023180 A S K G E E L F T G V V P I L V E L D G D V N ... 1 190
14 10 R 0.037609 A S K G E E L F T G V V P I L V E L D G D V N ... 4 195
5 14 P 0.063381 A S K G E E L F T G V V P I L V E L D G D V N ... 5 210

Let's quickly fill in the WT character for each row so we can plot the results.

results_df['wt_token_str'] = results_df.mask_pos.apply(lambda x: WILDTYPE[x])

results_df.sample(3)
token token_str score sequence model_num mask_pos wt_token_str
19 23 C 0.006759 A S K G E E L F T G V V P I L V E L D G D V N ... 5 127 I
13 5 A 0.032198 A S K G E E L F T G V V P I L V E L D G D V N ... 5 98 F
2 18 F 0.091468 A S K G E E L F T G V V P I L V E L D G D V N ... 2 87 M

Lastly, make a DF displaying a heatmap of the most probable stabilizing variants from the above in silico deep mutational scan.

heatmap_df = []  # Each row represents the full sequence, with a single token_str at each position

for residue in results_df.token_str.drop_duplicates().to_list():
    tmp_row = []
    for pos in range(len(WILDTYPE)):
        token_position_score = results_df.query('token_str == @residue & mask_pos == @pos').score.iloc[0]
        tmp_row.append(token_position_score)
    heatmap_df.append(tmp_row)
heatmap_df = pd.DataFrame(heatmap_df)

heatmap_df.shape
(20, 238)
heatmap_df.head(1).iloc[0][0]
0.9092302918434143
fig = plt.figure(figsize=[15, 4])

ax = sns.heatmap(heatmap_df)
_ = ax.set_xticklabels(list(WILDTYPE)[::int(len(WILDTYPE)/50)])
_ = ax.set_yticklabels(results_df.token_str.drop_duplicates())
_ = ax.set(xlabel='Wildtype Residue', ylabel='Variant')
No description has been provided for this image

This is a quick depiciton of the results. What you want to look for in the DF is mutations where the score is greater than the score of the wild-type residue at the same location. These can be extracted with some quick slicing of results_df, which we'll leave up to you to explore. There appear to be several mutations with greater likelihood that the wild-type sequence.

Next Steps

Check out additional tutorials at jupyter.biolm.ai, or head over to our BioLM Documentation to explore additional models and functionality.

See more use-cases and APIs on your BioLM Console Catalog.


BioLM hosts deep learning models and runs inference at scale. You do the science.

Contact us to learn more.

<span></span>

Accelerate yourLead generation

BioLM offers tailored AI solutions to meet your experimental needs. We deliver top-tier results with our model-agnostic approach, powered by our highly scalable and real-time GPU-backed APIs and years of experience in biological data modeling, all at a competitive price.

CTA

We speak the language of bio-AI

© 2022 - 2026 BioLM. All Rights Reserved.

ESM-1v Deep Mutational Scan | BioLM